.
The Open Protein Structure Annotation Network
PDB Keyword
.

1j8b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YbaB from Haemophilus influenzae (HI0442), a protein of unknown function coexpressed with the recombinational DNA repair protein RecR. Proteins 50 375-379 2003
    Site S2F
    PDB Id 1j8b Target Id HI0442
    Molecular Characteristics
    Source
    Alias Ids TPS14841, Molecular Weight 11968.30 Da.
    Residues 109 Isoelectric Point 4.99
    Sequence mfgkgglgglmkqaqqmqekmqkmqeeiaqlevtgesgaglvkitingahncrrididpslmeddkeml edliaaafndavrraeelqkekmasvtagmplppgmkfpf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.263
    Matthews' coefficent 2.09 Rfactor 0.18
    Waters 161 Solvent Content 41.29

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch