The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of Haemophilus Influenzae HI1715, an Oligoribonuclease. To be Published
    Site S2F
    PDB Id 1j9a Target Id HI1715
    Molecular Characteristics
    Alias Ids TPS14851, Molecular Weight 21198.28 Da.
    Residues 182 Isoelectric Point 5.73
    Sequence msfdkqnliwidlemtgldpekeriieiativtdknlnilaegpvlavhqsdellnkmndwcqkthsen glierikasklteraaelqtldflkkwvpkgaspicgnsiaqdkrflvkympdladyfhyrhldvstlk elaarwkpeilegfkkenthlalddiresikelayyrehfmkld
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.2986
    Matthews' coefficent 2.29 Rfactor
    Waters 139 Solvent Content 46.20

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch