.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jal

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YchF protein reveals binding sites for GTP and nucleic acid. J.BACTERIOL. 185 4031-4037 2003
    Site S2F
    PDB Id 1jal Target Id HI0393
    Molecular Characteristics
    Source
    Alias Ids TPS14853, Molecular Weight 39618.03 Da.
    Residues 362 Isoelectric Point 4.73
    Sequence gfkcgivglpnvgkstlfnaltkagieaanypfctiepntgvvpmpdprldalaeivkperilpttmef vdiaglvagaskgeglgnkflaniretdaighvvrcfenddivhvagkidplddidtintelaladlds ceraiqrlqkrakggdkeakfelsvmekilpvlenagmirsvgldkeelqaiksynfltlkptmyianv nedgfennpyldrvreiaakegavvvpvcaaieseiaelddeekveflqdlgieepglnrviragyall nlqtyftagvkevrawtvsvgatapkaaavihtdfekgfiraeviayedfiqfngengakeagkwrleg kdyivqdgdvmhfrfnv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.247
    Matthews' coefficent 3.00 Rfactor 0.204
    Waters 484 Solvent Content 59.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch