The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site S2F
    PDB Id 1joe Target Id HI0491
    Molecular Characteristics
    Alias Ids TPS14852, Molecular Weight 18395.05 Da.
    Residues 166 Isoelectric Point 5.28
    Sequence plldsfkvdhtkmnapavriaktmltpkgdnitvfdlrfcipnkeilspkgihtlehlfagfmrdhlng dsieiidispmgcrtgfymsligtpneqkvseawlasmqdvlgvqdqasipelniyqcgsytehsleda heiaknviargigvnknedlsldnsllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.2992000
    Matthews' coefficent 2.25 Rfactor 0.2053000
    Waters 134 Solvent Content 45.30

    Ligand Information
    Metals ZN (ZINC) x 4;HG (MERCURY) x 4



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch