.
The Open Protein Structure Annotation Network
PDB Keyword
.

1jos

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The 1.7-A Crystal Structure of HI1288 - Ribosome Binding Factor A (rbfA), a Cold Response Protein. To be Published
    Site S2F
    PDB Id 1jos Target Id HI1288
    Molecular Characteristics
    Source
    Alias Ids TPS14849, Molecular Weight 14804.37 Da.
    Residues 128 Isoelectric Point 5.76
    Sequence marefkrsdrvaqeiqkeiavilqrevkdprigmvtvsdvevssdlsyakifvtflfdhdemaieqgmk glekaspyirsllgkamrlrivpeirfiydqslvegmrmsnlvtnvvredekkhveesn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.283
    Matthews' coefficent 2.17 Rfactor 0.216
    Waters 169 Solvent Content 43.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch