.
The Open Protein Structure Annotation Network
PDB Keyword
.

1k1e

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title From structure to function: YrbI from Haemophilus influenzae (HI1679) is a phosphatase. Proteins 46 393-404 2002
    Site S2F
    PDB Id 1k1e Target Id HI1679
    Related PDB Ids 1j8d 
    Molecular Characteristics
    Source
    Alias Ids TPS14854, Molecular Weight 19431.24 Da.
    Residues 180 Isoelectric Point 5.51
    Sequence mqqklenikfvitdvdgvltdgqlhydangeaiksfhvrdglgikmlmdadiqvavlsgrdspilrrri adlgiklfflgkleketacfdlmkqagvtaeqtayigddsvdlpafaacgtsfavadapiyvknavdhv lsthggkgafremsdmilqaqgkssvfdtaqgflksvksmgq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.67 Rfree 0.225
    Matthews' coefficent 2.18 Rfactor 0.178
    Waters 1414 Solvent Content 43.57

    Ligand Information
    Ligands SO4 (SULFATE) x 18;GOL (GLYCEROL) x 6;MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 3
    Metals CO (COBALT) x 12;HG (MERCURY) x 12

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch