.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lqa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the Escherichia coli Tas protein, an NADP(H)-dependent aldo-keto reductase. PROTEINS: STRUCT.,FUNCT.,GENET. 53 323-325 2003
    Site S2F
    PDB Id 1lqa Target Id b2834
    Molecular Characteristics
    Source
    Alias Ids TPS14876, Molecular Weight 38497.47 Da.
    Residues 346 Isoelectric Point 6.27
    Sequence mqyhriphsslevstlglgtmtfgeqnseadahaqldyavaqginlidvaemypvpprpetqgltetyv gnwlakhgsrekliiaskvsgpsrnndkgirpdqaldrknirealhdslkrlqtdyldlyqvhwpqrpt ncfgklgyswtdsapavslldtldalaeyqragkiryigvsnetafgvmrylhladkhdlprivtiqnp ysllnrsfevglaevsqyegvellaysclgfgtltgkylngakpagarntlfsrftrysgeqtqkavaa yvdiarrhgldpaqmalafvrrqpfvastllgattmdqlktnieslhlelsedvlaeieavhqvytypap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.18589
    Matthews' coefficent 2.23 Rfactor 0.14515
    Waters 866 Solvent Content 44.90

    Ligand Information
    Ligands NDP (NADPH) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch