.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mw5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Novel structure and nucleotide binding properties of HI1480 from Haemophilus influenzae: a protein with no known sequence homologues. PROTEINS: STRUCT.,FUNCT.,GENET. 56 564-571 2004
    Site S2F
    PDB Id 1mw5 Target Id HI1480
    Molecular Characteristics
    Source
    Alias Ids TPS14863, Molecular Weight 17734.57 Da.
    Residues 156 Isoelectric Point 6.65
    Sequence msetdlllkmvrqpvklysvatlfhefsevitklehsvqkeptsllseenwhkqflkfaqalpahgsas wlnlddalqavvgnsrsaflhqliaklksrhlqvlelnkigsepldlsnlpapfyvllpesfaaritll vqdkalpyvrvsfeywha
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.243
    Matthews' coefficent 3.07 Rfactor 0.196
    Waters 209 Solvent Content 59.99

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch