The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of YciI from Haemophilus influenzae (HI0828) reveals a ferredoxin-like alpha/beta-fold with a histidine/aspartate centered catalytic site. Proteins 59 648-652 2005
    Site S2F
    PDB Id 1mwq Target Id HI0828
    Molecular Characteristics
    Alias Ids TPS14861, Molecular Weight 10964.86 Da.
    Residues 98 Isoelectric Point 5.02
    Sequence myyvifaqdipntlekrlavreqhlarlkqlqaenrlltagpnpaiddenpseagftgstviaqfenlq aakdwaaqdpyveagvyadvivkpfkkvf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 0.99 Rfree 0.1319
    Matthews' coefficent 2.00 Rfactor 0.1078
    Waters 329 Solvent Content 45.19

    Ligand Information
    Metals ZN (ZINC) x 4;CL (CHLORIDE) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch