.
The Open Protein Structure Annotation Network
PDB Keyword
.

1mxi

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the YibK methyltransferase from Haemophilus influenzae (HI0766): a Cofactor Bound at a Site Formed by a Knot. Proteins 51 56-67 2003
    Site S2F
    PDB Id 1mxi Target Id HI0766
    Related PDB Ids 1j85 
    Molecular Characteristics
    Source
    Alias Ids TPS14837, Molecular Weight 18400.45 Da.
    Residues 160 Isoelectric Point 9.12
    Sequence mldivlyepeipqntgniirlcantgfrlhlieplgftwddkrlrrsgldyhefaeikrhktfeafles ekpkrlfalttkgcpahsqvkfklgdylmfgpetrgipmsilnempmeqkiripmtansrsmnlsnsva vtvyeawrqlgykgavnlpevk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.254
    Matthews' coefficent 1.87 Rfactor 0.196
    Waters 153 Solvent Content 34.27

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 1
    Metals IOD (IODIDE) x 1

    Jmol

     

    Protein Summary

     

    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch