.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nng

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds. To be Published
    Site S2F
    PDB Id 1nng Target Id HI0827
    Molecular Characteristics
    Source
    Alias Ids TPS14867, Molecular Weight 16762.54 Da.
    Residues 154 Isoelectric Point 8.37
    Sequence msanftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnf ikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngrsrtipren nqelekalaliseqpl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.242
    Matthews' coefficent 2.74 Rfactor 0.186
    Waters 202 Solvent Content 55.16

    Ligand Information
    Ligands COA (COENZYME) x 2;GOL (GLYCEROL) x 2
    Metals CA (CALCIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch