The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of the highly acidic protein HI1450 from Haemophilus influenzae, a putative double-stranded DNA mimic. Proteins 54 375-383 2004
    Site S2F
    PDB Id 1nnv Target Id HI1450
    Molecular Characteristics
    Alias Ids TPS14862, Molecular Weight 12524.28 Da.
    Residues 107 Isoelectric Point 3.96
    Sequence mtteikkldpdtaidiaydiflemagenldpadillfnlqfeerggvefvetaddweeeigvlidpeey aevwvglvneqdemddvfakflishreedrefhviwkk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch