The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of yqgF from Escherichia coli, a hypothetical protein. To be Published
    Site S2F
    PDB Id 1nu0 Target Id yqgF
    Related PDB Ids 1nmn 
    Molecular Characteristics
    Alias Ids TPS14869, Molecular Weight 15185.49 Da.
    Residues 138 Isoelectric Point 6.74
    Sequence msgtllafdfgtksigvavgqritgtarplpaikaqdgtpdwniierllkewqpdeiivglplnmdgte qpltararkfanrihgrfgvevklhderlstvearsglfeqggyralnkgkvdsasaviilesyfeqgy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.228
    Matthews' coefficent 1.90 Rfactor 0.189
    Waters 248 Solvent Content 35.24

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch