The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the YffB protein from Pseudomonas aeruginosa suggests a glutathione-dependent thiol reductase function. Bmc Struct.Biol. 4 5-5 2004
    Site S2F
    PDB Id 1rw1 Target Id PA3664
    Molecular Characteristics
    Alias Ids TPS14879, Molecular Weight 13110.46 Da.
    Residues 115 Isoelectric Point 8.55
    Sequence mtyvlygikacdtmkkartwldehkvaydfhdykavgidrehlrrwcaehgwqtvlnragttfrkldea qkadldeakaielmlaqpsmikrpvlelggrtlvgfkpdayaaala
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.02 Rfree 0.139
    Matthews' coefficent 2.09 Rfactor 0.129
    Waters 660 Solvent Content 41.04

    Ligand Information
    Ligands IPA (ISOPROPYL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch