.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rxx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural insight into arginine degradation by arginine deiminase, an antibacterial and parasite drug target. J.Biol.Chem. 279 14001-14008 2004
    Site S2F
    PDB Id 1rxx Target Id PA5171
    Molecular Characteristics
    Source
    Alias Ids TPS14881, Molecular Weight 46433.55 Da.
    Residues 418 Isoelectric Point 5.52
    Sequence mstektklgvhseagklrkvmvcspglahqrltpsncdellfddviwvnqakrdhfdfvtkmrergidv lemhnlltetiqnpealkwildrkitadsvglgltselrswlesleprklaeyliggvaaddlpasega nilkmyreylghssfllpplpntqftrdttcwiyggvtlnpmywparrqetllttaiykfhpefanaef eiwygdpdkdhgsstleggdvmpigngvvligmgerssrqaigqvaqslfakgaaervivaglpksraa mhldtvfsfcdrdlvtvfpevvkeivpfslrpdpsspygmnirreektflevvaeslglkklrvvetgg nsfaaereqwddgnnvvclepgvvvgydrntytntllrkagvevitisaselgrgrggghcmtcpivrdpidy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.45 Rfree 0.264
    Matthews' coefficent 2.62 Rfactor 0.198
    Waters 492 Solvent Content 53.09

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch