.
The Open Protein Structure Annotation Network
PDB Keyword
.

2aiz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Peptidoglycan recognition by pal, an outer membrane lipoprotein. Biochemistry 45 2122-2128 2006
    Site S2F
    PDB Id 2aiz Target Id HI0381
    Molecular Characteristics
    Source
    Alias Ids TPS14866, Molecular Weight 16107.02 Da.
    Residues 153 Isoelectric Point 6.09
    Sequence mnkfvksllvagsvaalaacsssnndaagngaaqtfggysvadlqqryntvyfgfdkyditgeyvqild ahaaylnatpaakvlvegntdergtpeynialgqrradavkgylagkgvdagklgtvsygeekpavlgh deaaysknrravlay
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands UDP-AMU-ALA-DGL-6CL-DAL-DAL (URIDINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch