.
The Open Protein Structure Annotation Network
PDB Keyword
.

2apn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution NMR Structure of HI1723 From Haemophilus Influenzae. To be Published
    Site S2F
    PDB Id 2apn Target Id HI1723
    Molecular Characteristics
    Source
    Alias Ids TPS14844, Molecular Weight 12192.94 Da.
    Residues 114 Isoelectric Point 4.13
    Sequence middmavpltftdaaankvksliseeentdlklrvyitgggcsgfqygftfdekvndgdltieksgvql vidpmslqyliggtvdyteglegsrftvnnpnatstcgcgssfsi
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch