.
The Open Protein Structure Annotation Network
PDB Keyword
.

2out

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution structure of HI1506, a novel two-domain protein from Haemophilus influenzae. Protein Sci. 16 977-982 2007
    Site S2F
    PDB Id 2out Target Id HI1506
    Molecular Characteristics
    Source
    Alias Ids TPS14864, Molecular Weight 14121.96 Da.
    Residues 131 Isoelectric Point 5.20
    Sequence gshmdktfcvvvqnrikegyrragfsfhlgdnslaavsesqlaqlkadprlvvqitetgsqeggeglsk epagsdeqkqlradppstdlntftveqlkaqltergitfkqsatkaelialfapadgeksea
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch