The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Escherichia coli YdcF binds S-adenosyl-L-methionine and adopts an alpha/beta-fold characteristic of nucleotide-utilizing enzymes. Proteins 72 506-509 2008
    Site S2F
    PDB Id 3ca8 Target Id ydcF
    Molecular Characteristics
    Alias Ids TPS14873, Molecular Weight 29704.10 Da.
    Residues 266 Isoelectric Point 5.50
    Sequence mnitpfptlspatidainvigqwlaqddfsgevpyqadcvilagnavmptidaackiardqqipllisg gighsttflysaiaqhphyntirttgraeatiladiahqfwhiphekiwiedqstncgenarfsialln qavervhtaivvqdptmqrrtmatfrrmtgdnpdaprwlsypgfvpqlgnnadsvifinqlqglwpver ylslltgelprlrddsdgygprgrdfivhvdfpaevihawqtlkhdavlieamesrslr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.238
    Matthews' coefficent 2.64 Rfactor 0.195
    Waters 723 Solvent Content 53.35

    Ligand Information
    Ligands SO4 (SULFATE) x 8;MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 14



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch