The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site SECSG
    PDB Id 1mjf Target Id Pfu-132382-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9367, Molecular Weight 32332.74 Da.
    Residues 281 Isoelectric Point 5.78
    Sequence merafiewyprgygvafkikkkiyeklskyqkievyetegfgrllaldgtvqlvtlgersyheplvhpa mlahpkpkrvlvigggdggtvrevlqhdvdevimveidedvimvskdlikidnglleamlngkhekakl tigdgfefiknnrgfdviiadstdpvgpakvlfseefyryvydalnnpgiyvtqagsvylftdelisay kemkkvfdrvyyysfpvigyaspwaflvgvkgdidftkidrerakklqleyydplmhetlfqmpkyire tlqrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24156
    Matthews' coefficent 2.01 Rfactor 0.20482
    Waters 201 Solvent Content 38.95

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch