.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nnh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein from Pyrococcus furiosus Pfu-1801964. To be published
    Site SECSG
    PDB Id 1nnh Target Id Pfu-1801964-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9326, Molecular Weight 34052.54 Da.
    Residues 294 Isoelectric Point 5.19
    Sequence mnaveiisreisptldiqtkileymtdffvkegfkwllpviispitdplwpdpagegmepaeveiygvk mrlthsmilhkqlaiamglkkifvlspnirlesrqkddgrhayeftqldfeverakmedimrlierlvy glfrkaeewtgrefpktkrfevfeysevleefgsdekasqemeepfwiiniprefydrevdgfwrnydl ilpygygevasggereweyekivakirkaglnedsfrpyleiakagklkpsagagigverlvrfivgak hiaevqpfpripgipavi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.191
    Matthews' coefficent 2.53 Rfactor 0.171
    Waters 148 Solvent Content 50.91

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch