.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nnq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Pyrococcus furiosus: X-ray crystallography reveals 3D domain swapping in rubrerythrin. Proteins 57 878-882 2004
    Site SECSG
    PDB Id 1nnq Target Id Pfu-1210814-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9337, Molecular Weight 19499.54 Da.
    Residues 171 Isoelectric Point 5.67
    Sequence mvvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfialgklgkt penlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaelyrkakekaekgedieikk vyicpicgytavdeapeycpvcgapkekfvvfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.25252
    Matthews' coefficent 3.04 Rfactor 0.21117
    Waters 12 Solvent Content 59.16

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch