.
The Open Protein Structure Annotation Network
PDB Keyword
.

1nnw

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Southeast Collaboratory for Structural Genomics: hypothetical protein from Pyrococcus furiosus Pfu-1218608. To be published
    Site SECSG
    PDB Id 1nnw Target Id Pfu-1218608-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9305, Molecular Weight 28490.59 Da.
    Residues 252 Isoelectric Point 5.41
    Sequence mvyvavlaniagnlpaltaalsrieemreegyeiekyyilgnivglfpypkevievikdltkkenvkii rgkydqiiamsdphatdpgyidklelpghvkkalkftweklghegreylrdlpiylvdkiggnevfgvy gspinpfdgevlaeqptsyyeaimrpvkdyemlivaspmypvdamtrygrvvcpgsvgfppgkehkatf alvdvdtlkpkfieveydkkiieeriraeglpeeiikilyhggrp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.23498
    Matthews' coefficent 2.94 Rfactor 0.21592
    Waters 106 Solvent Content 57.79

    Ligand Information
    Ligands
    Metals NA (SODIUM) x 2;PT (PLATINUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch