.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ooe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis elegans: structure of dihydropteridine reductase. Proteins 53 944-946 2003
    Site SECSG
    PDB Id 1ooe Target Id T03F6.1
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9286, Molecular Weight 24711.61 Da.
    Residues 236 Isoelectric Point 6.51
    Sequence mssgkvivyggkgalgsaileffkkngytvlnidlsandqadsnilvdgnknwteqeqsileqtasslq gsqvdgvfcvaggwaggsasskdfvknadlmikqsvwssaiaaklatthlkpggllqltgaaaamgptp smigygmakaavhhltsslaakdsglpdnsavltimpvtldtpmnrkwmpnadhsswtplsfisehllk wttetssrpssgallkittengtstitpq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.65 Rfree 0.227
    Matthews' coefficent 2.05 Rfactor 0.194
    Waters 601 Solvent Content 39.50

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch