.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pry

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure determination of fibrillarin from the hyperthermophilic archaeon Pyrococcus furiosus. Biochem.Biophys.Res.Commun. 315 726-732 2004
    Site SECSG
    PDB Id 1pry Target Id Pfu-65527-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9321, Molecular Weight 25760.45 Da.
    Residues 227 Isoelectric Point 7.82
    Sequence mvevkkhkfpgvyvvidddgsekiatknlvpgqrvygervikwegeeyriwnphrsklgaaivnglknf pikpgksvlylgiasgttashvsdivgwegkiygiefsprvlrelvpiveerrniipilgdatkpeeyr alvtkvdvifedvaqptqakilidnakaylkrggygmiavksrsidvtkepeqvfkeverelseyfevi erlnlepyekdhalfvvrkp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.97 Rfree 0.25909
    Matthews' coefficent 2.74 Rfactor 0.20437
    Waters 158 Solvent Content 55.03

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch