.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qwk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural genomics of Caenorhabditis Elegans: Hypothetical 35.2 kDa protein (aldose reductase family member). To be published
    Site SECSG
    PDB Id 1qwk Target Id C07D8.6
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9287, Molecular Weight 35189.00 Da.
    Residues 317 Isoelectric Point 5.42
    Sequence mssatasiklsngvempviglgtwqsspaevitavktavkagyrlidtasvyqneeaigtaikelleeg vvkreelfittkawthelapgklegglreslkklqleyvdlylahmpaafnddmsehiaspvedvwrqf davykaglakavgvsnwnndqisralalgltpvhnsqvelhlyfpqhdhvdfckkhnisvtsyatlgsp grvnftlptgqkldwapapsdlqdqnvlalaekthktpaqvllryaldrgcailpksiqenrikenfev fdfslteediakleesknsqrlflqdfmtghpedafaaerk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.223
    Matthews' coefficent 2.18 Rfactor 0.2
    Waters 330 Solvent Content 43.20

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch