.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r9h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Genomics of C.elegans: FKBP-type Peptidylprolyl Isomerase. To be Published
    Site SECSG
    PDB Id 1r9h Target Id F31D4.3
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9284, Molecular Weight 48056.76 Da.
    Residues 431 Isoelectric Point 5.65
    Sequence msgekiditpkkdggvlklikkegqgvvkpttgttvkvhyvgtlengtkfdssrdrgdqfsfnlgrgnv ikgwdlgvatmtkgevaeftirsdygygdagsppkipggatlifevelfewsaedispdrdgtilrtii vegsknsfpndtskvlahcvgtyqgtefynrevnfhigegseeglpegveralrrfqlgekskieirgh kytygnsppagsnipvnatleftiflkefekvpatwemtaeekldaakqakdrgtmylqkgnlklaynk ykraeevleyekstdpekmaeretilngaylnlslvcskqneqlecikwcdkvletkpgnvkalyrkat alltmnevrdamklfekivevepenkaaaqqiivcrntireqnerdkkrfknlfakisteedkptntve dedeivastsgsstsna
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.227
    Matthews' coefficent 2.86 Rfactor 0.21
    Waters 110 Solvent Content 57.06

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch