The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of sperm-specific protein SSP-19 from Caenorhabditis elegans. Acta Crystallogr.,Sect.D 60 1840-1845 2004
    Site SECSG
    PDB Id 1row Target Id C55C2.2
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9285, Molecular Weight 11010.88 Da.
    Residues 109 Isoelectric Point 6.71
    Sequence msltadppactvpaagvssthklvnggaekivfkikssnnneyriapvfgfvdpsgskdvvitrtagap kedklvvhfasapadatdaqaafvavapagtvtipmsata
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.274
    Matthews' coefficent 1.96 Rfactor 0.225
    Waters 157 Solvent Content 36.80

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch