The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Dipolar Coupling Based Strategy for Simultaneous Resonance Assignment and Structure Determination of Protein Backbones. J.Am.Chem.Soc. 123 11791-11796 2001
    Site SECSG
    PDB Id 1rwd Target Id Pfu-1210573-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9303, Molecular Weight 6026.41 Da.
    Residues 54 Isoelectric Point 4.12
    Sequence makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch