.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ryq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Parameter-space screening: a powerful tool for high-throughput crystal structure determination. Acta Crystallogr.,Sect.D 61 520-527 2005
    Site SECSG
    PDB Id 1ryq Target Id Pfu-263306-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9332, Molecular Weight 6952.64 Da.
    Residues 61 Isoelectric Point 6.71
    Sequence msekacrhchyitsedrcpvcgsrdlseewfdlviivdvenseiakkigakvpgkyairvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.38 Rfree 0.20435
    Matthews' coefficent 1.93 Rfactor 0.19321
    Waters 34 Solvent Content 36.21

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch