.
The Open Protein Structure Annotation Network
PDB Keyword
.

1she

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein from Pyrococcus furiosus Pfu-871755-001. To be Published
    Site SECSG
    PDB Id 1she Target Id Pfu-871755-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9300, Molecular Weight 10642.88 Da.
    Residues 95 Isoelectric Point 5.01
    Sequence mstrgdlirilgeieekmnelkmdgfnpdiilfgreaynflsnllkkemeeegpfthvsnikieileel ggdavvidskvlglvpgaakrikiik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.22955
    Matthews' coefficent 2.32 Rfactor 0.2101
    Waters 39 Solvent Content 46.99

    Ligand Information
    Ligands
    Metals AU (GOLD) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch