.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sl8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title All three Ca2+-binding loops of photoproteins bind calcium ions: The crystal structures of calcium-loaded apo-aequorin and apo-obelin. Protein Sci. 14 663-675 2005
    Site SECSG
    PDB Id 1sl8 Target Id Aae-Aeq
    Molecular Characteristics
    Source Aequorea aequorea
    Alias Ids TPS9314, Molecular Weight 22513.06 Da.
    Residues 196 Isoelectric Point 4.78
    Sequence mtseqysvkltpdfdnpkwigrhkhmfnfldvnhngrisldemvykasdivinnlgatpeqakrhkdav eaffggagmkygvetewpeyiegwkrlaseelkrysknqitlirlwgdalfdiidkdqngaisldewka ytksdgiiqssedceetfrvcdidesgqldvdemtrqhlgfwytmdpaceklyggavp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.23635
    Matthews' coefficent 2.28 Rfactor 0.21573
    Waters 154 Solvent Content 46.07

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch