The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of a Ubiquitin-like Domain from Tubulin-binding Cofactor B. J.Biol.Chem. 279 46787-46793 2004
    Site SECSG
    PDB Id 1t0y Target Id F53F4.3
    Related PDB Ids 1lpl 1tov 
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9282, Molecular Weight 25439.30 Da.
    Residues 229 Isoelectric Point 4.70
    Sequence mtevydleittnatdfpmekkypagmslndlkkklelvvgttvdsmriqlfdgddqlkgeltdgakslk dlgvrdgyrihavdvtggnedfkdesmvekyemsddtygkrtdsvrawkkkmqeeqgsaapmenesdkl neeaaknimvgnrcevtvgaqmarrgevayvgatkfkegvwvgvkydepvgkndgsvagvryfdcdpky ggfvrpvdvkvgdfpelsidei
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch