The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Inorganic pyrophosphatase from Pyrococcus furiosus Pfu-264096-001. To be published
    Site SECSG
    PDB Id 1twl Target Id Pfu-264096-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9329, Molecular Weight 20912.07 Da.
    Residues 178 Isoelectric Point 4.91
    Sequence mnpfhdlepgpdvpevvyaiieipkgsrnkyeldkktgllkldrvlyspffypvdygiiprtwyedddp fdimvimrepvypltiiearpiglfkmidsgdkdykvlavpvedpyfkdwkdiddvpkafldeiahffk rykelqgkeiivegwegaeaakreilraiemykekfgkke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.2574
    Matthews' coefficent 2.08 Rfactor 0.1936
    Waters 35 Solvent Content 40.73

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch