.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ups

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Three-Dimensional Structure of Glcnacalpha1-4Gal Releasing Endo-Beta-Galactosidase from Clostridium Perfringens. Proteins: Struct.,Funct., Genet. 59 141 2005
    Site SECSG
    PDB Id 1ups Target Id Cpe-EBGal
    Molecular Characteristics
    Source Clostridium perfringens
    Alias Ids TPS9347, Molecular Weight 49374.39 Da.
    Residues 420 Isoelectric Point 5.03
    Sequence mfvfmlllllpftiskakdfpanpiekagykldfsdefngptldrekwtdyylphwckdpesakanyrf engslveyitedqkpwcpehdgtvrssaimsfdkswihnfsgttdnhernewrgyttkygyfeirakls ntgggghqawwmvgmqddtndwfnskqtgeidiletffskkdtwriaaygwndpnfqtswtisedkvps gdptseyhiyamewtptalkfyydnelfkviygspdyemgtilniytdagsgahndvwpkewaidymrv wkpvdgykeseslnnylirnrqtgkflyieenndkvsygditlkneknakwskeyrdgytllknnetge ylnienqtgyiehgkvpktwwsaqwsevpvdgytrfvnrwkpnmsihtesyegvlqygnvpntywtsqw qlipve
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.82 Rfree 0.204
    Matthews' coefficent 3.2 Rfactor 0.176
    Waters 378 Solvent Content 62

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch