.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vjk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative molybdopterin converting factor, subunit 1 from Pyrococcus furiosus, Pfu-562899-001 '. To be published
    Site SECSG
    PDB Id 1vjk Target Id Pfu-562899-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9323, Molecular Weight 10273.03 Da.
    Residues 90 Isoelectric Point 4.65
    Sequence mvkvkvkyfarfrqlagvdeeeielpegarvrdlieeikkrhekfkeevfgegydedadvniavngryv swdeelkdgdvvgvfppvsgg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.51 Rfree 0.2243
    Matthews' coefficent 2.72 Rfactor 0.21
    Waters 67 Solvent Content 54.83

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch