.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vk1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure solution of a ParB-like nuclease at atomic resolution. Proteins 70 263-267 2008
    Site SECSG
    PDB Id 1vk1 Target Id Pfu-392566-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9339, Molecular Weight 27705.69 Da.
    Residues 242 Isoelectric Point 5.09
    Sequence mgvekvpkydipvkkveyvfieldkmkpheqlvqreledfiesvtgsgifwkpmllakipgtdeylivd ghhrwaglqklgakrapsvildyfdegvkvytwypafkgdvnkvierlkaegleviedekaeekaekge iafaligeksfaipggleeqkkvskvldemdqakeielvyyglkedakadmekgeidyvfirkaptkee vmelvkrgevfspkttrhvlpfipdkidvkledlf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.175
    Matthews' coefficent 2.29 Rfactor 0.165
    Waters 137 Solvent Content 46.25

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals NA (SODIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch