The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Putative acetyl transferase from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1vkc Target Id Pfu-35386-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9364, Molecular Weight 17782.48 Da.
    Residues 150 Isoelectric Point 5.06
    Sequence meytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalnersellghv wicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkivlrveidnpavkwyeerg ykaralimekpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.89 Rfree 0.24419
    Matthews' coefficent 2.09 Rfactor 0.20726
    Waters 54 Solvent Content 41.01

    Ligand Information
    Metals IOD (IODIDE) x 13



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch