.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xhc

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title NADH oxidase /nitrite reductase from Pyrococcus furiosus Pfu-1140779-001. To be published
    Site SECSG
    PDB Id 1xhc Target Id Pfu-1140779-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS31864, Molecular Weight 39938.96 Da.
    Residues 359 Isoelectric Point 7.66
    Sequence mkvvivgngpggfelakqlsqtyevtvidkepvpyyskpmlshyiagfiprnrlfpysldwyrkrgiei rlaeeaklidrgrkvvitekgevpydtlvlatgararepqikgkeylltlrtifdadrikesiensgea iiigggfiglelagnlaeagyhvklihrgamflgldeelsnmikdmleetgvkfflnselleaneegvl tnsgfiegkvkicaigivpnvdlarrsgihtgrgiliddnfrtsakdvyaigdcaeysgiiagtakaam eqarvladilkgeprrynfkfrstvfkfgklqiaiigntkgegkwiedntkvfyengkiigavvfndir katklekeildfys
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.35 Rfree 0.2412
    Matthews' coefficent 2.61 Rfactor 0.2
    Waters 31 Solvent Content 52.79

    Ligand Information
    Ligands FAD (FLAVIN-ADENINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch