.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xhl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of putative Tropinone Reductase-II from Caenorhabditis Elegans with Cofactor and Substrate. To be Published
    Site SECSG
    PDB Id 1xhl Target Id F25D1.5
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9295, Molecular Weight 29350.89 Da.
    Residues 277 Isoelectric Point 6.22
    Sequence marfsgksviitgssngigrsaavifakegaqvtitgrnedrleetkqqilkagvpaekinavvadvte asgqddiinttlakfgkidilvnnaganladgtantdqpvelyqktfklnfqaviemtqktkehliktk geivnvssivagpqahsgypyyacakaaldqytrctaidliqhgvrvnsvspgavatgfmgamglpeta sdklysfigsrkecipvghcgkpeeianiivfladrnlssyiigqsivadggstlvmgmqthdlmsvlsq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.215
    Matthews' coefficent 3.70 Rfactor 0.191
    Waters 234 Solvent Content 66.80

    Ligand Information
    Ligands NDP (NADPH) x 2;TNE (8-METHYL-8-AZABICYCLO[3,2,1]OCTAN-3-ONE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch