.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xi3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Thiamine phosphate pyrophosphorylase from Pyrococcus furiosus Pfu-1255191-001. To be published
    Site SECSG
    PDB Id 1xi3 Target Id Pfu-1255191-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9325, Molecular Weight 22588.85 Da.
    Residues 207 Isoelectric Point 5.03
    Sequence mnlrnklklyvitdrrlkpevesvrealeggataiqmriknaptremyeigktlrqltreydalffvdd rvdvalavdadgvqlgpedmpievakeiapnliigasvysleealeaekkgadylgagsvfptktkeda rvigleglrkivesvkipvvaigginkdnarevlktgvdgiavisavmgaedvrkateelrkiveevlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.2147
    Matthews' coefficent 2.39 Rfactor 0.188
    Waters 264 Solvent Content 48.46

    Ligand Information
    Ligands SO4 (SULFATE) x 1;UNX (UNKNOWN) x 3
    Metals NI (NICKEL) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch