.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xi6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Extragenic suppressor from Pyrococcus furiosus Pfu-1862794-001. To be published
    Site SECSG
    PDB Id 1xi6 Target Id Pfu-1862794-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS31871, Molecular Weight 27926.70 Da.
    Residues 254 Isoelectric Point 5.12
    Sequence mklkfwrevaidiisdfettimpffgnpdggklvkispsgdetklvdklaedlilsritelgvnvvsee vgvidneseytvivdpldgsynfiagipffalslavfkkdkpiyaiiyepmterffegipgegaflngk rikvrktpdekpsisfysrgkgheivkhvkrtrtlgaialelaylamgaldgvvdvrkyvrptdiaagt iiakeagalikdsagkdidisfnatdrldviavnseellktilslle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.80 Rfree 0.29828
    Matthews' coefficent 4.24 Rfactor 0.27094
    Waters Solvent Content 70.97

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch