The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Divalent cation tolerant protein CUTA from Homo sapiens O60888. To be published
    Site SECSG
    PDB Id 1xk8 Target Id O60888
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS9356, Molecular Weight 16831.62 Da.
    Residues 156 Isoelectric Point 5.15
    Sequence mpallpvasrllllprvlltmasgspptqpspasdsgsgyvpgsvsaafvtcpnekvakeiaravvekr laacvnlipqitsiyewkgkieedsevlmmiktqsslvpaltdfvrsvhpyevaevialpveqgnfpyl qwvrqvtesvsdsitvlp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.70 Rfree 0.28316
    Matthews' coefficent 2.07 Rfactor 0.24459
    Waters Solvent Content 40.59

    Ligand Information
    Metals NA (SODIUM) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch