.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xma

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a transcriptional regulator from Clostridium thermocellum Cth-833. To be published
    Site SECSG
    PDB Id 1xma Target Id Cth-833
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9345, Molecular Weight 13415.56 Da.
    Residues 114 Isoelectric Point 7.89
    Sequence vissdvirgyvdtiilslliegdsygyeiskniriktdelyvikettlysafarlekngyiksyygeet qgkrrtyyritpegikyykqkceeweltkkvinkfvkelesngdn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.26676
    Matthews' coefficent 1.80 Rfactor 0.20534
    Waters 40 Solvent Content 31.81

    Ligand Information
    Ligands UNX (UNKNOWN) x 13
    Metals HG (MERCURY) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch