.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xqu

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title HIT family hydrolase from Clostridium thermocellum Cth-393. To be published
    Site SECSG
    PDB Id 1xqu Target Id Cth-393
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9365, Molecular Weight 12621.06 Da.
    Residues 114 Isoelectric Point 6.31
    Sequence lencvfckiikrelpstiyyederviaikdinpaapvhvliipkehianvkeinesnaqilidihkaan kvaedlgiaekgyrlitncgvaagqtvfhlhyhllggvdmgpkil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.326
    Matthews' coefficent 2.72 Rfactor 0.2777
    Waters 38 Solvent Content 54.78

    Ligand Information
    Ligands UNX (UNKNOWN) x 26
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch