.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xx7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein from Pyrococcus furiosus Pfu-403030-001. To be published
    Site SECSG
    PDB Id 1xx7 Target Id Pfu-403030-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9313, Molecular Weight 20176.35 Da.
    Residues 176 Isoelectric Point 4.99
    Sequence midlillagklkriprmgwlikgvpnpesvadhsyrvafitlllaeelkkkgveidvekalkiaiihdl geaiitdlplsaqkylnkeeaeakalkdvlpeytelfeeyskaltlegqlvkiadkldmiiqayeyels gaknlsefwnaledlekleisrylreiieevrrlkddh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.26 Rfree 0.2462
    Matthews' coefficent 2.71 Rfactor 0.1995
    Waters 69 Solvent Content 54.68

    Ligand Information
    Ligands UNX (UNKNOWN) x 19
    Metals NI (NICKEL) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch