.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y6j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title L-Lactate Dehydrogenase from Clostridium Thermocellum Cth-1135. To be Published
    Site SECSG
    PDB Id 1y6j Target Id Cth-1135
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9318, Molecular Weight 34831.41 Da.
    Residues 318 Isoelectric Point 5.83
    Sequence memvksrskvaiigagfvgasaaftmalrqtanelvlidvfkekaigeamdinhglpfmgqmslyagdy sdvkdcdvivvtaganrkpgetrldlakknvmiakevtqnimkyynhgvilvvsnpvdiitymiqkwsg lpvgkvigsgtvldsirfryllseklgvdvknvhgyiigehgdsqlplwscthiagknineyiddpkcn fteedkkkiaedvktagatiiknkgatyygiavsintivetllknqntirtvgtvingmygiedvaisl psivnsegvqevlqfnltpeeeealrfsaeqvkkvlnevknl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 3.01 Rfree 0.271
    Matthews' coefficent 3.79 Rfactor 0.229
    Waters Solvent Content 67.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch