.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yb3

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1yb3 Target Id Pfu-178653-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9349, Molecular Weight 19941.64 Da.
    Residues 167 Isoelectric Point 4.55
    Sequence mmlkevhellnriwgdifelreelkeelkgftveevsevfnaylyidgkweemkyphpafavkpggevg atpqgfyfvfafpkeelskefiedvirafeklfiygaenfledfynfehpisgdevwdrivnsdeemin fevdlgfdkeevkreikrfielarrynll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.2291
    Matthews' coefficent 2.79 Rfactor 0.2039
    Waters 102 Solvent Content 55.96

    Ligand Information
    Ligands UNX (UNKNOWN) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch