.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ybx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Cth-383 from Clostridium thermocellum. To be published
    Site SECSG
    PDB Id 1ybx Target Id Cth-383
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9343, Molecular Weight 11995.20 Da.
    Residues 113 Isoelectric Point 4.87
    Sequence makggfpgfggninnlvkqaqkmqrdmervqeelkektveasagggavtvvatgrkdikeitikpevvd pddvemlqdlilaavnealrkademvtaeiskitgglggipglf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.2564
    Matthews' coefficent Rfactor 0.2246
    Waters 90 Solvent Content

    Ligand Information
    Ligands UNX (UNKNOWN) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch