.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ybz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein from Pyrococcus furiosus Pfu-1581948-001. To be published
    Site SECSG
    PDB Id 1ybz Target Id Pfu-1581948-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9322, Molecular Weight 9070.28 Da.
    Residues 76 Isoelectric Point 9.57
    Sequence mttlkllrkeidkidnqiisllkkrleiaqaigkikkelnlpiedrkreeevlrragefreifekilev skdvqrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.82 Rfree 0.2366
    Matthews' coefficent 2.54 Rfactor 0.2009
    Waters 61 Solvent Content 51.63

    Ligand Information
    Ligands UNX (UNKNOWN) x 3
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch